PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G002800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 151aa    MW: 17435.4 Da    PI: 10.7627
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G002800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.61.9e-262271352
              RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                        ++i+l ++++yF+lpik+A+k L++++++LK +CRqyGI+RWPhRkiksl
  Sevir.7G002800.1.p 22 DSITLVNIAQYFHLPIKEASKALKIGVSALKTKCRQYGIPRWPHRKIKSL 71
                        689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.769691IPR003035RWP-RK domain
PfamPF020425.9E-222471IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MVYAELAPPV QKQPRANRKR VDSITLVNIA QYFHLPIKEA SKALKIGVSA LKTKCRQYGI  60
PRWPHRKIKS LDSLIHDLEY VLTTEDGHQD EWLQNKNAAA IKALKEKKKL LESEKEAIRQ  120
KPALDLRTET KLFRQLVFKR KNNARLKVKD *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012702814.11e-106PREDICTED: protein RKD5-like
TrEMBLK3YEI31e-106K3YEI3_SETIT; Uncharacterized protein
STRINGSi012648m1e-106(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.14e-25RWP-RK domain-containing protein